SUSAN JEFFERS ~ FEEL THE FEAR AND DO IT ANYWAY ~ 1987

~ YCAFASAFOLRTABTS ~ You Can Accept Fear As Simply A Fact Of Life Rather Than A Barrier To Success

~ ATBOEOOYFISTFTYCHWLMBY ~ At The Bottom Of Every One Of Your Fears Is Simply The Fear That You Can’t Handle Whatever Life May Bring You

~ IYKYCHATCYW-WWYPHTF? ~ If You Knew You Could Handle Anything That Came Your Way – What Would You Possibly Have To Fear?

~ AYHTDTDYFITDMTIYATHWCYW ~ All You Have To Do To Diminish Your Fear Is To Develop More Trust In Your Ability To Handle Whatever Comes Your Way!

~ WHTM-GAS-ICHI ~ Whatever Happens To Me – Given Any Situation – I Can Handle It!

~ I-EFFWASTNIL-Y-SMAOT-‘DI’-DTF-TWMCT-FINTP ~ If – Everybody Feels Fear When Approaching Something Totally New In Life – Yet – So Many Are Out There – “Doing It” – Despite The Fear – Then We Must Conclude That – Fear Is Not The Problem

~ IAPAIAL-IAPAIAL-IAPAILI ~ I Am Powerful And I Am Loved – I Am Powerful And I Am Loving – I Am Powerful And I Love It

~ P-T-PV ~ Pain-To-Power Vocabulary

~ TTIYRAIC-ITC-YATCOY-R-TETHTY-KRTWYANTR-YPYIAPOP-AH-DYATHTFIYL ~ The Truth Is You Really Are In Control – In Total Control – You Are The Cause Of Your – Reactions – To Everything That Happens To You – Keep Remembering That Whenever You Are Not Taking Responsibility – You Put Yourself In A Position Of Pain – And Hence – Decrease Your Ability To Handle The Fear In Your Life

~ IIAE-THTSOA-S-M-A-I-GOP ~ It Is Amazingly Empowering – To Have The Support Of A – Strong – Motivated – And – Inspirational – Group Of People

~ WPILWMYG?-TITPTT ~ Which Path In Life Will Make You Grow? – That Is The Path To Take

~ N-W-M ~ No-Win – Model

~ N-L-M ~ No-Lose – Model

~ TKT-YCHATCYW-ITKTAYTT-H-L-A-R ~ The Knowledge That – You Can Handle Anything That Comes Your Way – Is The Key To Allowing Yourself To Take – Healthy – Life-Affirming – Risks

~ YNAFIYDMI;YASBYT ~ You’re Not A Failure If You Don’t Make It; You’re A Success Because You Try

~ A-ITKTYS ~ Action – Is The Key To Your Success

~ AO-P-IVI-DID ~ Acknowledgement Of – Pain – Is Very Important – Denial Is Deadly

~ S-Y-MGUAAOYBTYCCMAPIWLHY ~ Saying – Yes – Means Getting Up And Acting On Your Belief That You Can Create Meaning And Purpose In Whatever Life Hands You

~ TWIFWPWHBH-T-W-LHTO-A-THCOW! ~ The World Is Filled With People Who Have Been Handed – The – “Worst” – Life Has To Offer – And – They Have Come Out Winners!

~ IAY-‘G’-IA-‘G’-THFYWB ~ If All Your – “Giving” – Is About – “Getting” – Think How Fearful You Will Become

~ GGINOA;IAMUFB ~ Genuine Giving Is Not Only Altruistic; It Also Makes Us Feel Better

~ WWGFAPOL-RT-FAPOE-MUCBTUTWCEHI ~ When We Give From A Place Of Love – Rather Than – From A Place Of Expectation – More Usually Comes Back To Us Than We Could Ever Have Imagined

~ GAT ~ Give Away Thanks

~ GAI ~ Give Away Information

~ GAP ~ Give Away Praise

~ YMBWYWTA-BTKOPWWWTSYW ~ You Must Become What You Want To Attract – Be The Kind Of Person You Would Want To Surround Yourself With

~ GAT ~ Give Away Time

~ GAM ~ Give Away Money

~ GAL ~ Give Away Love

~ TLITBATG-A-NITTTB ~ To Love Is To Be Able To Give – And – Now Is The Time To Begin

~ YLIA-A-YC! ~ Your Life Is Abundant – And – You Count!

~ IWDNCACFOTSPOO-WWNETKO-J-S-S-A-C-WAAS ~ If We Do Not Consciously And Consistently Focus On The Spiritual Part Of Ourselves – We Will Never Experience The Kind Of – Joy – Satisfaction – Safety – And – Connectedness – We Are All Seeking

~ WCTBRIOHWTINWTBR? ~ Why Choose To Be Right Instead Of Happy When There Is No Way To Be Right?

~ TIPOT ~ There Is Plenty Of Time

RICHARD WISEMAN ~ 59 SECONDS ~ 2011

~ TWDNFICOTL-ALS-ALPAPH-T-TWDFIC `~ Those Who Do Not Feel In Control Of Their Lives – Are Less Successful – And – Less Psychologically And Physically Healthy – Than – Those Who Do Feel In Control

~ WPCATNIL-AIIIDNRIASHL ~ When People Can Afford The Necessities In Life – An Increase In Income Does Not Result In A Significantly Happier Life

~ TRSTA-50%-OYOSOHIGD-ASCBA-A-10%-IATGC-TADTC-TR-40%-IDFYD-T-DBATWYTAYAO ~ The Research Shows That About – 50 Percent – Of Your Overall Sense Of Happiness Is Genetically Determined – And So Cannot Be Altered – Another – 10 Percent – Is Attributable To General Circumstances – That Are Difficult To Change – The Remaining – 40 Percent – Is Derived From Your Day-To-Day Behavior And The Way You Think About Yourself And Others

~ TPITTAOISS-HBACIAOWTROSR ~ The Problem Is That The Advice Offered In Some Self-Help Books And Courses Is At Odds With The Results Of Scientific Research

~ FAPP-TAWAVD-TCATASOC-B-WPAMS-S-BA ~ From A Psychological Perspective – Thinking And Writing Are Very Different – Talking Can Add To A Sense Of Confusion – But – Writing Provides A More Systematic – Solution-Based Approach

~ B-E-N-G-WICTH-R-IIETRRGVFTM ~ Buy – Experiences – Not – Goods – When It Comes To Happiness – Remember – It Is Experiences That Represent Really Good Value For The Money

~ PSWTAH-B-TAFHBTAS ~ People Smile When They Are Happy – But – They Also Feel Happier Because They Are Smiling

~ TMH-CIC-O-CC-S-B-T ~ To Maximize Happiness – Choose Intentional Change – Over – Circumstantial Change – Start – Begin – Try

~ TEOTLY-AFTH ~ To Encourage Others To Like You – Ask For Their Help

~ FE-BF-PLYMWTDAFFY-MLTWWSFRTMSR ~ Franklin Effect – Benjamin Franklin – People Like You More When They Do A Favor For You – More Likely To Work With Small Favors Rather Than More Significant Requests

~ PE-TOSCEYL-H-TERWOWYAIDOBSATP ~ Pratfall Effect – The Occasional Slipup Can Enhance Your Likeability – However – The Effect Really Works Only When You Are In Danger Of Being Seen As Too Perfect

~ G-KTWTYATOALTCHTR-BVAPOYOP ~ Gossip – Know That Whatever Traits You Assign To Others Are Likely To Come Home To Roost – Being Viewed As Part Of Your Own Personality

~ PAMLTAWYWTHASSP ~ People Are More Likely To Agree With You When They Have Already Said Something Positive

~ SYT-PBR-M-M-L-A-R ~ Save Your Time – Persuade By Rhyme – More – Memorable – Likeable – And – Repeatable

~ WLPWALU-A-WFTFMPTO ~ We Like People Who Are Like Us – And – We Find Them Far More Persuasive Than Others

~ U-BMPARTSOFTC-ELTEEFP-A-TGCEUDTDN ~ Unfortunately – Because Most People Are Reluctant To Stand Out From The Crowd – Everyone Looks To Everyone Else For Pointers – And – The Group Can End Up Deciding To Do Nothing

~ ‘B’-E-TMPWAAWAPIAINOA-TLTLTAOPWAH-TAITPOAFFITCACTTWIHAWTNTO ~ “Bystander” – Effect – The More People Who Are Around When A Person Is Apparently In Need Of Assistance – The Lower The Likelihood That Any One Person Will Actually Help – The Answer Is To Pick Out A Friendly Face In The Crowd And Clearly Tell Them What Is Happening And What They Need To Do

~ WLPWHU-A-WHPWL-IYWTHY-YNTHOF ~ We Like People Who Help Us – And – We Help People We Like – If You Want To Help Yourself – You Need To Help Others First

~ FAYPWMMYFB-B-IIUTHYTYDIR ~ Fantasizing About Your Perfect World May Make You Feel Better – But – It Is Unlikely To Help You Transform Your Dreams Into Reality

~ TOAYAAHYAT-IPBFAFOPM-NSWTGGT ~ Telling Others About Your Aims Also Helps You Achieve Them – In Part Because Friends And Family Often Provide Much-Needed Support When The Going Gets Tough

~ WIYOG? ~ What Is Your Overall Goal?

~ BYOGIAMO-FSS-ESSBAWAGTI-CM-R-A-T-B ~ Break Your Overall Goal Into A Maximum Of – Five Small Steps – Each Step Should Be Associated With A Goal That Is – Concrete Measurable – Realistic – And – Time-Based

~ WATBOAYOG?-LTIB-FOHMBLWBFYATAY-TB-RT-ETNAOYCS ~ What Are The Benefits Of Achieving Your Overall Goal? – List Three Important Benefits – Focusing On How Much Better Life Will Be For You And Those Around You – The Benefits – Rather Than – Escaping The Negative Aspects Of Your Current Situation

~ TBOWYOE-EPTCHTWLTBRATDHVMB-I-H-TI-L-TG-A-ATDTWTAPTMTGAR ~ The Benefits Of Writing Your Own Eulogy – Encouraging People To Consider How They Would Like To Be Remembered After Their Death Has Various Motivational Benefits – Including – Helping – To Identify – Long-Term Goals – And – Assess The Degree To Which They Are Progressing Toward Making Those Goals A Reality

~ ATTCUW-I-A-PAMCAFTW-IIAUP ~ Ask Them To Come Up With – Ideas – And – People Are More Creative Away From The Crowd – It Is A Universal Phenomenon

~ OOTMIPUC:TRTAIOTFOSCBATA ~ One Of The Most Important Principles Underlying Creativity: The Realization That An Idea Or Technique From One Situation Can Be Applied To Another

~ G-ST-RAB-IAST-MPMC ~ Greenery – Seems To – Reduce Antisocial Behavior – It Also Seems To – Make People More Creative

~ WPFW-TB-R-A-ROW-EHAR-A-STWTL-CE ~ When People Feel Worried – They Become – Risk-Averse – Rely On Well-Established Habits And Routines – And – See The World Through Less-Creative Eyes

~ WPFAE-TAMLT-ENAUWOTAB-STBP-TR-A-TAAMC ~ When People Feel At Ease – They Are More Likely To – Explore New And Unusual Ways Of Thinking And Behaving – See The Bigger Picture – Take Risks – And – Think And Act More Creatively

~ CTFAJTIAETSBTICTFAFJ-ANEJSTTCAS-AT-MD ~ Cookies Taken From A Jar That Is Almost Empty Taste Significantly Better Than Identical Cookies Taken From A Full Jar – A Near Empty Jar Suggests That The Cookies Are Scarce – And Therefore – More Desirable

~ AGTIPAASOHS-IYWTGSTHYO-TTBOTOTUA ~ A Gentle Touch Is Perceived As A Sign Of High Status – If You Want To Get Someone To Help You Out – Try The Briefest Of Touches On The Upper Arm

~ NEAEAFMNAHAGIOTWWTABTTPC ~ Negative Events And Experiences Are Far More Noticeable And Have A Greater Impact On The Way We Think And Behave Than Their Positive Counterparts

~ SYWOTRYOYPIGFYR ~ Surrounding Yourself With Objects That Remind You Of Your Partner Is Good For Your Relationship

~ TVOA-DNETF-IIFMLTPGOTF ~ The Venting Of Anger – Does Not Extinguish The Flame – It Is Far More Likely To Pour Gasoline Onto The Fire

~ BIAG-EPO-CTTMAMEDTTWOTO ~ Being In A Group – Exaggerates People’s Opinions – Causing Them To Make A More Extreme Decision Than They Would On Their Own

~ CT-I-G-TTB-MD-BATJIA-MLTSTAAHM-A-MATFSVOO ~ Compared To – Individuals – Groups – Tend To Be – More Dogmatic – Better Able To Justify Irrational Actions – More Likely To See Their Actions As Highly Moral – And – More Apt To Form Stereotypical Views Of Outsiders

~ I-WASA-EPBAWHOF-I-HWF-HWSO-A-HWATO N~ Instead – We Are Social Animals – Easily Persuaded By A Whole Host Of Factors – Including – How We Feel – How We See Ourselves – And – How We Appear To Others

DANIEL PINK ~ THE POWER OF RESTORATIVE BREAKS – GUIDING PRINCIPLES ~ WHEN ~ 2018

~ SBN ~ Something Beats Nothing

~ FSBAMETOO ~ Frequent Short Breaks Are More Effective Than Occasional Ones

~ SBAE-E-‘M-B-CBH ~ Short Breaks Are Effective – Even – “Micro-breaks” – Can Be Helpful

~ MBS-SSUAWA-F-FM-EHDTW-CBP ~ Moving Beats Stationary – Simply Standing Up And Walking Around – For – Five Minutes – Every Hour During The Workday – Can Be Potent

~ SBS-TACBR-B-SB-AMEARSAIM ~ Social Beats Solo – Time Alone Can Be Replenishing – But – Social Breaks – Are More Effective At Reducing Stress And Improving Mood

~ OBI-NBMRUTB ~ Outside Beats Inside – Nature Breaks May Replenish Us The Best

~ FDBS ~ Fully Detached Beats Semidetached

DANIEL PINK ~ WHEN ~ RIVERHEAD BOOKS ~ 2018

~ WAKT-TIE-TI-WDKMAT ~ We All Know That – Timing Is Everything – Trouble Is – We Don’t Know Much About Timing

~ OCADNRSOTCOAD-WA-S/F/S/MC/LC-ISPOTDTO-TDFAMETWR ~ Our Cognitive Abilities Do Not Remain Static Over The Course Of A Day – We Are – Smarter / Faster / Dimmer / Slower / More Creative / Less Creative – In Some Parts Of The Day Than Others – These Daily Fluctuations Are More Extreme Than We Realize

~ WWWUOBTSR-T-GBO-ELAA-A-T-EOEF-OATC-OPOD ~ When We Wake Up Our Body Temperature Slowly Rises – That – Gradually Boosts Our – Energy Levels And Alertness – And That – Enhances Our Executive Functioning – Our Ability To Concentrate – Our Powers Of Deduction

~ AAEL-PDTA-WTDCAC-FIOATRF-A-COI ~ Alertness And Energy Levels – Plummet During The Afternoons – With That Drop Comes A Corresponding – Fall In Our Ability To Remain Focused – And – Constrain Our Inhibitions

~ B-IPAD-TRLVAFI-ATLM-AFDCHUSCWMHMWOFWT-FAP-LOIC-IAB-FIP-IAF ~ But – Insight Problems Are Different – They Require Less Vigilance And Fewer Inhibitions – At Those Looser Moments – A Few Distractions Can Help Us Spot Connections We Might Have Missed When Our Filters Were Tighter – For Analytic Problems – Lack Of Inhibitory Control – Is A Bug – For Insight Problems – It’s A Feature

~ AOUETDITS-AP-AT-A-AR-WYD-DNLMTCIYPP ~ All Of Us Experience The Day In Three Stages – A Peak – A Trough – And – A Rebound – Whatever You Do – Do Not Let Mundane Tasks Creep Into Your Peak Period

~ TMPLBHTKI-A-A-D-BPAP ~ The Most Powerful Lunch Breaks Have Two Key Ingredients – Autonomy – And – Detachment – Both Psychological And Physical

~ LITMIMOTD ~ Lunch Is The Most Important Meal Of The Day

~ N-CTKB-TICP-A-TBMAPH ~ Naps – Confer Two Key Benefits – They Improve Cognitive Performance – And – They Boost Mental And Physical Health

~ SAANCRBP ~ Simply Anticipating A Nap Can Reduce Blood Pressure

~ BHAFGITMOUU-B-IF-CMTTE ~ Beginnings Have A Far Greater Impact Than Most Of Us Understand – Beginnings – In Fact – Can Matter To The End

~ IME-WSBATTPOBAATMASS-ITF-MAFS-A-ITBIBYC-WCEOTAAGS ~ In Most Endeavors – We Should Be Awake To The Power Of Beginnings And Aim To Make A Strong Start – If That Fails – Make A Fresh Start – And – If The Beginning Is Beyond Our Control – We Can Enlist Others To Attempt A Group Start

~ BSWUFLTWK-TELTTE ~ Beginnings Stay With Us Far Longer Than We Know – Their Effects Linger To The End

~ WWRA-M-SWS-B-OTWJ-AMSAUTWSHOOT-U-O-WROOT ~ When We Reach A – Midpoint – Sometimes We Slump – But – Other Times We Jump – A Mental Siren Alerts Us That We’ve Squandered Half Of Our Time – Uh-Oh – We’re Running Out Of Time

~ TEPOESMOOOASD-NBTFE-B-BCM-EATE ~ The Encoding Power Of Endings Shapes Many Of Our Opinions And Subsequent Decisions – Not By The Full Experience – But – By Certain Moments – Especially At The End

~ Y-WEBS-WWEA-AT-OAK-WSO-ERP-A-SO-AOA-N-WB-TCF-WE ~ Yet – When Endings Become Salient – Whenever We Enter An – Act Three – Of Any Kind – We Sharpen Our – Existential Red Pencils – And – Scratch Out – Anyone Or Anything – Nonessential – Well Before – The Curtain Falls – We Edit

~ PITACW-L-RLTCMMTTPWKIWS-N ~ People Informed That A Chocolate Was – Last – Reported Liking That Chocolate Much More Than The People Who Knew It Was Simply – Next

~ TBEDLU-H-I-TP-AROUI-AFMOT ~ The Best Endings Don’t Leave Us – Happy – Instead – They Produce – A Rush Of Unexpected Insight – A Fleeting Moment Of Transcendence

~ C/C/C-ITE-WSM ~ Closings / Conclusions / Culminations – In The End – We Seek Meaning

~ B-PSOTAE-IALTIE-IPTHAS ~ Belongingness – Profoundly Shapes Our Thoughts And Emotions – Its Absence Leads To Ill Effects – Its Presence To Health And Satisfaction

~ IUTBT-TWE-N-IBT-EIT ~ I Used To Believe That – Timing Was Everything – Now – I Believe That – Everything Is Timing

ANDREW PIPER ~ BOOK WAS THERE ~ 2012

~ TPLINOAROR-ICABAA ~ The Private Library Is Not Only A Refuge Of Reading – It Can Also Be An Asylum

~ TL-TPOB-IATPBOO ~ The Library – The Place Of Books – Is Also The Potential Birthplace Of Obsessions

~ PB-HOTB-CKUFL ~ Possessing Books – Holding On To Books – Can Keep Us From Life

~ BAHWSTTDATD ~ Books Are How We Speak To The Distant And The Dead

~ NRCTETIOMWFL-NPAIOOTBWODNI-RB-WSOOL-ROOTMEMOESET ~ New Research Continues To Emphasize The Importance Of Mind Wandering For Learning – Not Paying Attention Is One Of The Best Ways Of Discovering New Ideas – Reading Books – Whether Silently Or Out Loud – Remains One Of The Most Efficient Means Of Enabling Such Errant Thinking

~ WALOSOTO-WAN-‘AO’ ~ We Are Losing Our Sense Of Time Online – We Are Now – “Always On”

~ FIOOTBCOTD-WWLASWBPT-TOEOCTS ~ Fatigue Is One Of The Basic Conditions Of The Digital – When We Look At Screens We Become Prematurely Tired – The Optical Equivalent Of Carpal Tunnel Syndrome

~ WM-DIB-O-AITC-B-WSTTW ~ We May – Dream In Books – Or – Awake In The Cinema – But – We Sleepwalk Through The Web

~ TINOTNT-E-TEDS-TO-O ~ There Is No Outside The Network Today – Except – The Ever Dwindling Space-Time Of – Off

~ WHRTAWBTIOP ~ We Have Returned To A World Before The Invention Of Privacy

~ RIBFW-B-IABMW-B-WAABAN ~ Reading Is Born From Writing – But – It Also Begets More Writing – But – Writing Almost Always Begins As Notes

~ TCB-COWCDFOR-ICTWOAW-WFW-ERWLHTITWSTTCUTLO-INWAINS ~ The Commonplace Book – Consists Of Words Copied Down From Our Reading – In Copying The Words Of Another Writer – Word For Word – Early Readers Were Learning How To Internalize Those Words So That They Could Use Them Later On – In New Ways And In New Settings

~ RINPAAOI-WWR-WEIAWOC-WO-L-S-O-MP-RS ~ Reading Is Never Purely An Act Of Isolation – When We Read – We Enter Into A World Of Commonality – Whether Of – Language – Story – Or – Material Place – Reading Socializes

~ C-TIIOTLNOIP-A-C-BSACGAII-IBIO-S-CIIWOOASOTHOHH-WDITCSTBUT-WIANLYOMBO ~ Copyright – The Initial Idea Of The Limited Nature Of Intellectual Property – A – Compromise – Between Serving A Common Good And Individual Incentive – Is Becoming Increasingly One-Sided – Corporate Interest Is Winning Out Over A Sense Of The History Of Human Habit – What Disappears Is That Common Space That Binds Us Together – Where Ideas Are No Longer Yours Or Mine But Ours

~ ITIA-S-OT-IICL-NOAEMFOILTTBC-UTAILI-B-TRSWOCDWSMABIE ~ If There Is A – Singularity – Out There – It Is Copyright Law – Not Only Are Ever More Facets Of Intellectual Life Thought To Be Copyrightable – Up To And Including Life Itself – But – The Restrictions Surrounding What Others Can Do With Such Material Are Becoming Increasingly Extensive

~ LT-E-TIAAOTC-TPD(N-TIC)-TIDATOLAEUTD ~ Like The – “Environment” – There Is An Abstraction Out There Called – The Public Domain (Now – The Intellectual Commons) – That Is Diminishing And That Our Laws Are Encouraging Us To Diminish

~ BATODE ~ Books Are The Original Difference Engines

~ BT-E-B-A-G-B-DFTWF-BT ~ Both The – English – Book – And – German – Buch – Derive From The Word For – Beech Tree

~ T-L-C-TTTUFB-DFTWFTOAT ~ The – Latin – Codex – The Technical Term Used For Books – Derives From The Word For Trunk Of A Tree

~ LANARTOAAADAL ~ Literacy And Numeracy Are Related To One Another At A Deep Anthropological Level

~ TH-OC-AB-TMTR ~ There Has – Of Course – Always Been – Too Much To Read

~ MIRM ~ Melancholy Is Reading’s Muse

BRONNIE WARE ~ THE TOP FIVE REGRETS OF THE DYING ~ 2011

~ IWID-TCTLALTTM-N-TLOEOM ~ I Wish I’d Had – The Courage To Live A Life True To Myself – Not – The Life Others Expected Of Me

~ IWIH-WSH ~ I Wish I Hadn’t – Worked So Hard

~ IWIH-TCTEMF ~ I Wish I’d Had – The Courage To Express My Feelings

~ IWIH-SITWMF ~ I Wish I Had – Stayed In Touch With My Friends

~ IWIH-LMBH ~ I Wish I Had – Let Myself Be Happier

NEIL POSTMAN ~ AMUSING OURSELVES TO DEATH ~ 1983

~ PDITAOSB ~ Public Discourse In The Age Of Show Business

~ TNITM ~ The Medium Is The Metaphor

~ O-P-R-N-E-A-C-HBTI-CAO-SB-TRITWAAPOTVOAOTD ~ Our – Politics – Religion – News – Athletics – Education – And – Commerce – Have Been Transformed Into – Congenial Adjuncts Of – Show Business – The Result Is That We Are A People On The Verge Of Amusing Ourselves To Death

~ IETWC-AIIETGBTFOTTI ~ In Every Tool We Create – An Idea Is Embedded That Goes Beyond The Function Of The Thing Itself

~ OMAOM-OMCTCOOC ~ Our Media Are Our Metaphors – Our Metaphors Create The Content Of Our Culture

~ ENTIAT-IGATA ~ Every New Technology For Thinking Involves A Tradeoff – It Giveth And Taketh Away

~ TFIWIAE-AWTIWB ~ The Form In Which Ideas Are Expressed – Affects What Those Ideas Will Be

~ TAOSB ~ The Age Of Show Business

~ C-FI-HODIOTIPYOM-ROT-OI-TMP- CYTAYPFTD-O-TTSAYWNOHT-OPI-ISPYARTS? ~ Context-Free Information – How Often Does It Occur That Information Provided You On Morning – Radio Or Television – Or In – The Morning Newspaper – Causes You To Alter Your Plans For The Day – Or – To Take Some Action You Would Not Otherwise Have Taken – Or – Provides Insight Into Some Problem You Are Required To Solve?

~ B-MOODNII-COITGUSTTABCLTAMA ~ But – Most Of Our Daily News Is Inert – Consisting Of Information That Gives Us Something To Talk About But Cannot Lead To Any Meaningful Action

~ AGLOI:TNEFYAVOOAWYCDNETOTAMN-AWYCDN ~ A Great Loop Of Impotence: The News Elicits From You A Variety Of Opinions About Which You Can Do Nothing Except To Offer Them As More News – About Which You Can Do Nothing

~ EBEB-FTFT-WWSIWANQWHA-AW-IAC-DNPAR ~ Everything Became Everyone’s Business – For The First Time – We Were Sent Information Which Answered No Question We Had Asked – And Which – In Any Case – Did Not Permit A Reply

~ AP-CIASITGFAIIASU-B-TUTP-CPIN-A-O-P-S-O-C-IITOULFIWNGCTOL-AT-OC-IT-A ~ A Pseudo-Context Is A Structure Invented To Give Fragmented And Irrelevant Information A Seeming Use – But – The Use The Pseudo-Context Provides Is Not – Action – Or – Problem-Solving – Or – Change – It Is The Only Use Left For Information With No Genuine Connection To Our Lives – And That – Of Course – Is To – Amuse

~ TINSOPI-P/N/E/R/S/S-TDNFIWTT-WMTAPUOTSISBTBOT ~ There Is No Subject Of Public Interest – Politics / News / Education / Religion / Science / Sports – That Does Not Find Its Way To Television – Which Means That All Public Understanding Of These Subjects Is Shaped By The Biases Of Television

~ WRTAT-OWIOT-TI-IC-IE-WINOIPCASCBTCIWWNATI-ITFG-AAN-O-CIAAILTSIT-ASMIPAE ~ We Rarely Talk About Television – Only What Is On Television – That Is – Its Content – Its Ecology – Which Includes Not Only Its Physical Characteristics And Symbolic Code But The Conditions In Which We Normally Attend To It – Is Taken For Granted – Accepted As Natural – One – Cultural Institution After Another Is Learning To Speak Its Terms – All Subject Matter Is Presented As Entertaining

~ TIOCPMOKAI-T-ATITCP-HTSTWBTMFHTWIPTBS-TNODICATDLBWISBAWINBHTSWEPD-TNBBSB ~ Television Is Our Culture’s Principal Mode Of Knowing About Itself – Therefore – And This Is The Critical Point – How Television Stages The World Becomes The Model For How The World Is Properly To Be Staged – The Nature Of Discourse Is Changing As The Demarcation Line Between What Is Show Business And What Is Not Becomes Harder To See With Each Passing Day – There’s No Business But Show Business

~ ‘N…T’ ~ “Now… This”

~ IOT-CRRATDTOT-T-PLNNTTVMWRPTTPCGASOV-OMLLALBBTTT-OEW-LLAT-TBIFBL ~ If On Television – Credibility Replaces Reality As The Decisive Test Of Truth-Telling – Political Leaders Need Not Trouble Themselves Very Much With Reality Provided That Their Performances Consistently Generate A Sense Of Verisimilitude – One May Look Like A Liar But Be Telling The Truth – Or Even Worse – Look Like A Truth-Teller But In Fact Be Lying

~ TIATMO-‘BI’-BCASOITMPBCD-MI-M-I-F-O-S-I-SFMST-BDOAI ~ Television Is Altering The Meaning Of – “Being Informed”– By Creating A Species Of Information That Might Properly Be Called Disinformation – Misleading Information – Misplaced – Irrelevant – Fragmented – Or – Superficial – Information – Something Far More Serious Than – Being Deprived Of Authentic Information

~ TTCINAAATCOP-IIATCOTC ~ The Television Commercial Is Not At All About The Character Of Products – It Is About The Character Of The Consumers

~ TTCHOBAF-MBOV-Y-MCFV-WMT-TBOBHNBP-T-TCIAPABP-D ~ The Television Commercial Has Oriented Business Away From – Making Products Of Value – Toward – Making Consumers Feel Valuable – Which Means That – The Business Of Business Has Now Become Pseudo-Therapy – The Consumer Is A Patient Assured By Psycho-Dramas

~ TITLOAGTC:P-AS-AS-O-AF-TCFVACACIOT ~ This Is The Lesson Of All Great Television Commercials: Provide – A Slogan – A Symbol – Or – A Focus – That Creates For Viewers A Comprehensive And Compelling Image Of Themselves

~ IT-AOSAIP-PDIENOOICBOHCAW ~ ~ In The – Age Of Show Business And Image Politics – Political Discourse Is Emptied Not Only Of Ideological Content But Of Historical Content – As Well

~ TOAVHAKATVOPTMWAAAMOPD-B-MOTCNHEHFASIWTMWITWDNA-TKTCINNWAPDTTFOAJ ~ Tyrants Of All Varieties Have Always Known About The Value Of Providing The Masses With Amusements As A Means Of Pacifying Discontent – But – Most Of Them Could Not Have Even Hoped For A Situation In Which The Masses Would Ignore That Which Does Not Amuse – To Know That Censorship Is Not A Necessity When All Political Discourse Takes The Form Of A Jest

~ TATWBWTSOACMBS-TO:CBAP-TH:CBB ~ There Are Two Ways By Which The Spirit Of A Culture May Be Shriveled – The Orwellian: Culture Becomes A Prison – The Huxleyan – Culture Becomes A Burlesque

~ IMLDIOWAIBR-OL-WI-TGOTPAEI-SER-I-WEP ~ It Makes Little Difference If Our Wardens Are Inspired By Right- Or Left-Wing Ideologies – The Gates Of The Prison Are Equally Impenetrable – Surveillance Equally Rigorous – Icon-Worship Equally Pervasive

~ A-O-WIMETR-ATO-TA-H ~ An – Orwellian – World Is Much Easier To Recognize – And To Oppose – Than A – Huxleyan

~ PCHNYATPTTII-TISOTFTBOVETHAEAOL ~ Public Consciousness Has Not Yet Assimilated The Point That Technology Is Ideology – This In Spite Of The Fact That Before Our Very Eyes Technology Has Altered Every Aspect Of Life

~ TBATATCEWAPFSC-TMTTIN-TMTATTIAAFTCI-ATLH-SPAS ~ To Be Unaware That A Technology Comes Equipped With A Program For Social Change – To Maintain That Technology Is Neutral – To Make The Assumption That Technology Is Always A Friend To Culture Is – At This Late Hour – Stupidity Plain And Simple

~ NMIEDIIUUWIDA-TAITBTS ~ No Medium Is Excessively Dangerous If Its Users Understand What Its Dangers Are – To Ask Is To Break The Spell

~ TCTOCT-TTPDWHISPSFID-WGU-U-IWBNTTMCAS-O-LRODHBOGVTL-SO-B-HSVLOITMP-A-HCALAMPFTATMHS ~ The Central Thesis Of Computer Technology – That The Principal Difficulty We Have In Solving Problems Stems From Insufficient Data – Will Go Unexamined – Until – It Will Be Noticed That The Massive Collection And Speed-Of-Light Retrieval Of Data Have Been Of Great Value To Large-Scale Organizations – But – Have Solved Very Little Of Importance To Most People And – Have Created At Least As Many Problems For Them As They May Have Solved

~ MC ~ Media Conscious

~ WATP-BNW-WNTTWLIOT-B-TTDNKWTWLAAWTHST ~ What Afflicted The People In – Brave New World – Was Not That They Were Laughing Instead Of Thinking – But – That They Did Not Know What They Were Laughing About And Why They Had Stopped Thinking